Family with Sequence Similarity 20, Member C (FAM20C) antibody

Antigen: Family with Sequence Similarity 20, Member C (FAM20C)

Synonyms: RNS, DMP4, DKFZp547C074

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN311188

Additional Information

Alternative name: Dentin matrix protein 4

Gene ID: FAM20C

UniProt: Q8IXL6

Immunogen: The immunogen for anti-FAM20C antibody: synthetic peptide directed towards the middle region of human FAM20C

Sequence: CFYGECSYYCSTEHALCGKPDQIEGSLAAFLPDLSLAKRK TWRNPWRRSY

Cross-Reactivity: Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-FAM20C antibody concentration is 1 mg/ml.

Description: FAM20C belongs to the FAM20 family. FAM20C is a calcium-binding protein which may play a role in dentin mineralization. Mutations in FAM20C are associated with lethal osteosclerotic bone dysplasia (Raine Syndrome), highlighting a crucial molecule in bone development.

Characteristics: Antigen Size: 584 amino acids

Molecular Weight: 66kDa

Application Details

Application Notes: WB Suggested Anti-FAM20C Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-FAM20C Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Publications

Product: Simpson, Hsu, Keir et al.: "Mutations in FAM20C are associated with lethal osteosclerotic bone dysplasia (Raine syndrome), highlighting a crucial molecule in bone development." in: American journal of human genetics, Vol. 81, Issue 5, pp. 906-12, 2007 (PubMed).