Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Family with Sequence Similarity 20, Member C (FAM20C) antibody

Antigen

Family with Sequence Similarity 20, Member C (FAM20C)

Synonyms RNS, DMP4, DKFZp547C074
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Chicken

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN311188
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name Dentin matrix protein 4
Gene ID FAM20C
UniProt Q8IXL6
Immunogen The immunogen for anti-FAM20C antibody: synthetic peptide directed towards the middle region of human FAM20C
Sequence CFYGECSYYCSTEHALCGKPDQIEGSLAAFLPDLSLAKRK TWRNPWRRSY
Cross-Reactivity Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-FAM20C antibody concentration is 1 mg/ml.
Description FAM20C belongs to the FAM20 family. FAM20C is a calcium-binding protein which may play a role in dentin mineralization. Mutations in FAM20C are associated with lethal osteosclerotic bone dysplasia (Raine Syndrome), highlighting a crucial molecule in bone development.
Characteristics Antigen Size: 584 amino acids
Molecular Weight 66kDa

Application Details

Application Notes WB Suggested Anti-FAM20C Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Simpson, Hsu, Keir et al.: "Mutations in FAM20C are associated with lethal osteosclerotic bone dysplasia (Raine syndrome), highlighting a crucial molecule in bone development." in: American journal of human genetics, Vol. 81, Issue 5, pp. 906-12, 2007 (PubMed).

Alternatives

Alternatives for antigen "Family with Sequence Similarity 20, Member C (FAM20C)", type "Antibodies"
Hosts Rabbit (7)
Reactivities Human (5), Chicken (1), Dog (Canine) (1), Mouse (Murine) (1), Rat (Rattus) (1), Zebrafish (1)
Applications Western Blotting (WB) (7), ELISA (4), Immunohistochemistry (IHC) (1), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (1)
Epitopes C-Term (3), Internal Region (1)