Ectonucleoside Triphosphate diphosphohydrolase 7 (ENTPD7) antibody

Antigen: Ectonucleoside Triphosphate diphosphohydrolase 7 (ENTPD7)

Synonyms: LALP1, NTPDase7

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus), Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN311190

Additional Information

Alternative name: ENTPD7 / LALP1

Gene ID: ENTPD7

UniProt: Q9NQZ7

Immunogen: The immunogen for anti-ENTPD7 antibody: synthetic peptide directed towards the C terminal of human ENTPD7

Sequence: EHRLKYQCFKSAWMYQVLHEGFHFPYDYPNLRTAQLVYDR EVQWTLGAIL

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ENTPD7 antibody concentration is 1 mg/ml.

Description: ENTPD7 is a multi-pass membrane protein.It belongs to the GDA1/CD39 NTPase family. It preferentially hydrolyzes nucleoside 5'-triphosphates. The order of activity with respect to possible substrates is UTP > GTP > CTP.

Characteristics: Antigen Size: 604 amino acids

Molecular Weight: 69kDa

Application Details

Application Notes: WB Suggested Anti-ENTPD7 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ENTPD7 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain

Publications

Product: Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).