Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Neuroligin Y antibody

Antigen

Neuroligin Y

Synonyms KIAA0951
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Dog (Canine), Zebrafish, Xenopus laevis

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN311202
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Gene ID NLGN4X
UniProt Q8NFZ3
Immunogen The immunogen for anti-NLGN4X antibody: synthetic peptide directed towards the middle region of human NLGN4X
Sequence ELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTK FIHTKPNRFE
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-NLGN4X antibody concentration is 1 mg/ml.
Description NLGN4X is a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. It interacts with discs, large (Drosophila) homolog 4 (DLG4). NLGN4X might play a role in the autism and Asperger syndrome.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests. This gene encodes a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. The encoded protein interacts with discs, large (Drosophila) homolog 4 (DLG4). Mutations in this gene have been associated with autism and Asperger syndrome. Two transcript variants encoding the same protein have been identified for this gene.
Characteristics Antigen Size: 816 amino acids
Molecular Weight 92kDa

Application Details

Application Notes WB Suggested Anti-NLGN4X Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Wermter, Kamp-Becker, Strauch et al.: "No evidence for involvement of genetic variants in the X-linked neuroligin genes NLGN3 and NLGN4X in probands with autism spectrum disorder on high functioning level." in: American journal of medical genetics. Part B, Neuropsychiatric genetics : the official publication of the International Society of Psychiatric Genetics, Vol. 147B, Issue 4, pp. 535-7, 2008 (PubMed).

Alternatives

Alternatives for antigen "Neuroligin Y", type "Antibodies"
Hosts Rabbit (27), Mouse (1)
Reactivities Human (28), Mouse (Murine) (3), Rat (Rattus) (3), Chicken (2), Cow (Bovine) (2), Dog (Canine) (2), Cat (Feline) (1), Xenopus laevis (1), Zebrafish (1)
Applications Immunofluorescence (IF) (16), Western Blotting (WB) (13), ELISA (12), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunohistochemistry (IHC) (2), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1)
Epitopes N-Term (1), N-Term,AA 138-167 (1)