Sema Domain, Transmembrane Domain (TM), and Cytoplasmic Domain, (Semaphorin) 6D (SEMA6D) antibody

Antigen: Sema Domain, Transmembrane Domain (TM), and Cytoplasmic Domain, (Semaphorin) 6D (SEMA6D)

Synonyms: FLJ11598, KIAA1479, AA409156, Sema6D-1, Sema6D-2, Sema6D-4, Sema6D-5, Sema6D-6, mKIAA1479, D330011G23, 1110067B02Rik, zgc:112012, si:ch211-278n20.1, DKFZp459F1523

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken, Zebrafish, Xenopus laevis

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN311204

Additional Information

Alternative name: SEMA6D

Gene ID: SEMA6D

UniProt: Q8NFY4

Immunogen: The immunogen for anti-SEMA6D antibody: synthetic peptide directed towards the N terminal of human SEMA6D

Sequence: VSFPEDDEPLNTVDYHYSRQYPVFRGRPSGNESQHRLDFQ LMLKIRDTLY

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SEMA6D antibody concentration is 1 mg/ml.

Description: Semaphorins are a large family, including both secreted and membrane associated proteins, many of which have been implicated as inhibitors or chemorepellents in axon pathfinding, fasciculation and branching, and target selection. All semaphorins possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Additional sequence motifs C-terminal to the semaphoring domain allow classification into distinct subfamilies. Results demonstrate that transmembrane semaphorins, like the secreted ones, can act as repulsive axon guidance cues. SEMA6D is a class 6 vertebrate transmembrane semaphorin that demonstrates alternative splicing. Six transcript variants have been identified and expression of the distinct encoded isoforms is thought to be regulated in a tissue- and development-dependent manner.Semaphorins are a large family, including both secreted and membrane associated proteins, many of which have been implicated as inhibitors or chemorepellents in axon pathfinding, fasciculation and branching, and target selection. All semaphorins possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Additional sequence motifs C-terminal to the semaphorin domain allow classification into distinct subfamilies. Results demonstrate that transmembrane semaphorins, like the secreted ones, can act as repulsive axon guidance cues. This gene encodes a class 6 vertebrate transmembrane semaphorin that demonstrates alternative splicing. Six transcript variants have been identified and expression of the distinct encoded isoforms is thought to be regulated in a tissue- and development-dependent manner.

Characteristics: Antigen Size: 476 amino acids

Molecular Weight: 52kDa

Application Details

Application Notes: WB Suggested Anti-SEMA6D Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Neurology

Restrictions: For Research Use only

Images

WB Suggested Anti-SEMA6D Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate

Publications

Product: Toyofuku, Zhang, Kumanogoh et al.: "Dual roles of Sema6D in cardiac morphogenesis through region-specific association of its receptor, Plexin-A1, with off-track and vascular endothelial growth factor receptor type 2." in: Genes & development, Vol. 18, Issue 4, pp. 435-47, 2004 (PubMed).