Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311226

NIPA-Like Domain Containing 2 (NIPAL2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms NPAL2, 9330161F08Rik, Npal2, RGD1564315
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311226
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NPAL2 antibody: synthetic peptide directed towards the N terminal of human NPAL2
Sequence AAVAPAGPGDSASAALDELSLNFTYGAPGAGNGSLSGDWY RRNQIHLFGV
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against NPAL2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name NPAL2
Background NPAL2 is a multi-pass membrane protein and it belongs to the NIPA family. The exact function of NPAL2 remains unknown.
Molecular Weight 41kDa
Gene ID 79815
NCBI Accession NP_079035, NM_024759
UniProt Q9H841
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NPAL2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lefèvre, Bouadjar, Karaduman et al.: "Mutations in ichthyin a new gene on chromosome 5q33 in a new form of autosomal recessive congenital ichthyosis." in: Human molecular genetics, Vol. 13, Issue 20, pp. 2473-82, 2004 (PubMed).

Alternatives for antigen "NIPA-Like Domain Containing 2 (NIPAL2)", type "Antibodies"
Hosts (17)
Reactivities (16), (15), (12), (12), (12)
Applications (10), (8), (4), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (2), (1)
Beacon