Did you know that you can buy products from over 140 different suppliers from us?

NIPA-Like Domain Containing 2 (NIPAL2) (N-Term) antibody

Details for Product No. ABIN311226
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms NPAL2, 9330161F08Rik, Npal2, RGD1564315
Epitope
N-Term
(9), (7), (2)
Reactivity
Human
(22), (14), (12), (12), (12)
Host
Rabbit
(23)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(14), (10), (9), (3)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN311226
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human NPAL2
Sequence AAVAPAGPGDSASAALDELSLNFTYGAPGAGNGSLSGDWY RRNQIHLFGV
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against NPAL2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name NPAL2
Background NPAL2 is a multi-pass membrane protein and it belongs to the NIPA family. The exact function of NPAL2 remains unknown.
Molecular Weight 41 kDa
Gene ID 79815
NCBI Accession NM_024759, NP_079035
UniProt Q9H841
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 368 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Lefèvre, Bouadjar, Karaduman et al.: "Mutations in ichthyin a new gene on chromosome 5q33 in a new form of autosomal recessive congenital ichthyosis." in: Human molecular genetics, Vol. 13, Issue 20, pp. 2473-82, 2004 (PubMed).

Hosts (23)
Reactivities (22), (14), (12), (12), (12)
Applications (14), (10), (9), (3)
Conjugates (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (9), (7), (2)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN311226
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top