Surfeit 4 (SURF4) antibody

Antigen: Surfeit 4 (SURF4)

Synonyms: ERV29, FLJ22993, MGC102753, SURF-4, DmelCG6202, CG6202, SURF4, MGC88894, MGC165910, GB14656, Surf4, DKFZp459A164

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Xenopus laevis, Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN311256

Additional Information

Alternative name: SURF4

Gene ID: SURF4

UniProt: O15260

Immunogen: The immunogen for anti-SURF4 antibody: synthetic peptide directed towards the N terminal of human SURF4

Sequence: GQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDG IRMWFQWSEQ

Cross-Reactivity: Cow (Bovine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SURF4 antibody concentration is 1 mg/ml.

Description: SURF4 is a conserved integral membrane protein containing multiple putative transmembrane regions. In eukaryotic cells, protein transport between the endoplasmic reticulum and Golgi compartments is mediated in part by non-clathrin-coated vesicular coat proteins (COPs). The specific function of this protein has not been determined but its yeast homolog is directly required for packaging glycosylated pro-alpha-factor into COPII vesicles. This gene is located in the surfeit gene cluster, which is comprised of very tightly linked housekeeping genes that do not share sequence similarity. The encoded protein is a conserved integral membrane protein containing multiple putative transmembrane regions. In eukaryotic cells, protein transport between the endoplasmic reticulum and Golgi compartments is mediated in part by non-clathrin-coated vesicular coat proteins (COPs). The specific function of this protein has not been determined but its yeast homolog is directly required for packaging glycosylated pro-alpha-factor into COPII vesicles. This gene uses multiple polyadenylation sites, resulting in transcript length variation. The existence of alternatively spliced transcript variants has been suggested, but their validity has not been determined.

Characteristics: Antigen Size: 269 amino acids

Molecular Weight: 30kDa

Application Details

Application Notes: WB Suggested Anti-SURF4 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Lung.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Organelles

Restrictions: For Research Use only

Images

WB Suggested Anti-SURF4 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Lung

Publications

Product: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).