Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Lipase Maturation Factor 2 (LMF2) antibody

Antigen

Lipase Maturation Factor 2 (LMF2)

Synonyms Tmem112b, RGD1306274, xlmf2, MGC53562, BC002942, MGC128522, zgc:194766, CH73-30N17.3, MGC145062
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish, Xenopus laevis

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN311257
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name TMEM112B / TMEM153
Gene ID LMF2
UniProt Q9BU23
Immunogen The immunogen for anti-LMF2 antibody: synthetic peptide directed towards the middle region of human LMF2
Sequence YVEPGTHGRLWTGAHRLFGAVEHLQLANSYGLFRRMTGLG GRPEVVLEGS
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-LMF2 antibody concentration is 1 mg/ml.
Description LMF2 belongs to the lipase maturation factor family. LMF2 is involved in the maturation of specific proteins in the endoplasmic reticulum. It may be required for maturation and transport of active lipoprotein lipase (LPL) through the secretory pathway.
Characteristics Antigen Size: 682 amino acids
Molecular Weight 77kDa

Application Details

Application Notes WB Suggested Anti-LMF2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Alternatives

Alternatives for antigen "Lipase Maturation Factor 2 (LMF2)", type "Antibodies"
Hosts Rabbit (9)
Reactivities Human (8), Mouse (Murine) (4), Rat (Rattus) (4), Cat (Feline) (1), Chicken (1), Cow (Bovine) (1), Dog (Canine) (1)
Applications Western Blotting (WB) (9), ELISA (8), Immunohistochemistry (IHC) (5), Immunofluorescence (IF) (1), Immunoprecipitation (IP) (1)
Epitopes C-Term (2), Internal Region (1)