RFT1 Homolog (S. Cerevisiae) (RFT1) antibody

Antigen: RFT1 Homolog (S. Cerevisiae) (RFT1)

Synonyms: CDG1N, FLJ25945, DKFZp667J092, GB14370

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Rat (Rattus), Mouse (Murine), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN311263

Additional Information

Alternative name: RFT1

Gene ID: RFT1

UniProt: Q96AA3

Immunogen: The immunogen for anti-RFT1 antibody: synthetic peptide directed towards the N terminal of human RFT1

Sequence: GTQRDWSQTLNLLWLTVPLGVFWSLFLGWIWLQLLEVPDP NVVPHYATGV

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-RFT1 antibody concentration is 1 mg/ml.

Description: N-glycosylation of proteins follows a highly conserved pathway that begins with the synthesis of a¡¡Man(5)GlcNAc(2)-dolichylpyrophosphate (PP-Dol) intermediate on the cytoplasmic side of the endoplasmic reticulum (ER) membrane followed by the translocation of Man(5)GlcNAc (2)-PP-Dol to the luminal side of the ER membrane. RFT1 is the flippase enzyme that catalyzes this translocation.N-glycosylation of proteins follows a highly conserved pathway that begins with the synthesis of a Man(5)GlcNAc(2)-dolichylpyrophosphate (PP-Dol) intermediate on the cytoplasmic side of the endoplasmic reticulum (ER) membrane followed by the translocation of Man(5)GlcNAc (2)-PP-Dol to the luminal side of the ER membrane. RFT1 is the flippase enzyme that catalyzes this translocation (Helenius et al., 2002 [PubMed 11807558]).[supplied by OMIM].

Characteristics: Antigen Size: 541 amino acids

Molecular Weight: 60kDa

Application Details

Application Notes: WB Suggested Anti-RFT1 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling, Metabolism

Restrictions: For Research Use only

Images

WB Suggested Anti-RFT1 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Publications

Product: Haeuptle, Pujol, Neupert et al.: "Human RFT1 deficiency leads to a disorder of N-linked glycosylation." in: American journal of human genetics, Vol. 82, Issue 3, pp. 600-6, 2008 (PubMed).