UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 13 (GalNAc-T13) (GALNT13) (N-Term) antibody

Details for Product No. ABIN311266
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms GalNAc-T13, H_NH0187G20.1, WUGSC:H_NH0187G20.1, T13, BB182356, A230002A12, A230020F20, si:ch1073-215b15.1
Epitope
N-Term
(13), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Human, Chicken
(18), (13), (12), (12), (12), (12)
Host
Rabbit
(17), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (9), (4), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN311266
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human GALNT13
Sequence CNKCDDKKERSLLPALRAVISRNQEGPGEMGKAVLIPKDD QEKMKELFKI
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, African clawed frog : 80 %
Characteristics This is a rabbit polyclonal antibody against GALNT13. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name GALNT13
Background The GALNT13 protein is a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAcT, EC 2.4.1.41) family, which initiate O-linked glycosylation of mucins by the initial transfer of N-acetylgalactosamine (GalNAc) with an alpha-linkage to a serine or threonine residue.The GALNT13 protein is a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAcT, EC 2.4.1.41) family, which initiate O-linked glycosylation of mucins (see MUC3A, MIM 158371) by the initial transfer of N-acetylgalactosamine (GalNAc) with an alpha-linkage to a serine or threonine residue.
Molecular Weight 64 kDa
Gene ID 114805
NCBI Accession NM_052917, NP_443149
UniProt Q8IUC8
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 556 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 13 (GalNAc-T13) (GALNT13) (N-Term) antibody WB Suggested Anti-GALNT13 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate
Background publications Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4...." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).

Hosts (17), (2)
Reactivities (18), (13), (12), (12), (12), (12)
Applications (10), (9), (4), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (13), (1), (1), (1), (1)
back to top