UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 13 (GalNAc-T13) (GALNT13) antibody

Antigen: UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 13 (GalNAc-T13) (GALNT13)

Synonyms: FLJ16031, FLJ41157, KIAA1918, MGC119459, MGC119461, GalNAc-T13, H_NH0187G20.1, WUGSC:H_NH0187G20.1, T13, MGC83963, MGC143063, MGC145354

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN311266

Additional Information

Alternative name: GALNT13

Gene ID: GALNT13

UniProt: Q8IUC8

Immunogen: The immunogen for anti-GALNT13 antibody: synthetic peptide directed towards the N terminal of human GALNT13

Sequence: CNKCDDKKERSLLPALRAVISRNQEGPGEMGKAVLIPKDD QEKMKELFKI

Cross-Reactivity: Cow (Bovine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-GALNT13 antibody concentration is 1 mg/ml.

Description: The GALNT13 protein is a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAcT, EC 2.4.1.41) family, which initiate O-linked glycosylation of mucins by the initial transfer of N-acetylgalactosamine (GalNAc) with an alpha-linkage to a serine or threonine residue.The GALNT13 protein is a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAcT, EC 2.4.1.41) family, which initiate O-linked glycosylation of mucins (see MUC3A, MIM 158371) by the initial transfer of N-acetylgalactosamine (GalNAc) with an alpha-linkage to a serine or threonine residue.[supplied by OMIM].

Characteristics: Antigen Size: 556 amino acids

Molecular Weight: 64kDa

Application Details

Application Notes: WB Suggested Anti-GALNT13 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-GALNT13 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate

Publications

Product: Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).