Monoacylglycerol O-Acyltransferase 1 (MOGAT1) antibody

Antigen: Monoacylglycerol O-Acyltransferase 1 (MOGAT1)

Synonyms: mDC2, MGAT1, Dgat2l, Dgat2l1, MGC118035, 0610030A14Rik, 1110064N14Rik, DGAT2L, DGAT2L1

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Dog (Canine), Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN311273

Additional Information

Alternative name: MOGAT1

Gene ID: MOGAT1

UniProt: Q96PD6

Immunogen: The immunogen for anti-MOGAT1 antibody: synthetic peptide directed towards the C terminal of human MOGAT1

Sequence: PIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIP EHETLVLK

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-MOGAT1 antibody concentration is 1 mg/ml.

Description: Acyl-CoA:monoacylglycerol acyltransferase (MOGAT, EC 2.3.1.22) catalyzes the synthesis of diacylglycerols, the precursor of physiologically important lipids such as triacylglycerol and phospholipids.Acyl-CoA:monoacylglycerol acyltransferase (MOGAT, EC 2.3.1.22) catalyzes the synthesis of diacylglycerols, the precursor of physiologically important lipids such as triacylglycerol and phospholipids (Yen et al., 2002 [PubMed 12077311]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-48 AF384163.1 1-48 49-1056 BN000154.1 1-1008 1057-1096 AF384163.1 1054-1093

Characteristics: Antigen Size: 335 amino acids

Molecular Weight: 39kDa

Application Details

Application Notes: WB Suggested Anti-MOGAT1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-MOGAT1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver

Publications

Product: Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).