Zinc Finger Protein 780B (ZNF780B) antibody

Antigen: Zinc Finger Protein 780B (ZNF780B)

Synonyms: ZNF779

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN311287

Additional Information

Alternative name: ZNF780B

Gene ID: ZNF780B

UniProt: Q9Y6R6

Immunogen: The immunogen for anti-ZNF780B antibody: synthetic peptide directed towards the N terminal of human ZNF780B

Sequence: RWYPDLESKYGPEKISPENDIFEINLPKHVIKQISKTLGL EAFYFRNDSE

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF780B antibody concentration is 1 mg/ml.

Description: ZNF780B belongs to the krueppel C2H2-type zinc-finger protein family. It contains 23 C2H2-type zinc fingers and 1 KRAB domain. ZNF780B may be involved in transcriptional regulation.

Characteristics: Antigen Size: 833 amino acids

Molecular Weight: 97kDa

Application Details

Application Notes: WB Suggested Anti-ZNF780B Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF780B Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate

Publications

Product: Grimwood, Gordon, Olsen et al.: "The DNA sequence and biology of human chromosome 19." in: Nature, Vol. 428, Issue 6982, pp. 529-35, 2004 (PubMed).