Zinc Finger, MYND-Type Containing 17 (ZMYND17) antibody

Antigen: Zinc Finger, MYND-Type Containing 17 (ZMYND17)

Synonyms: FLJ39565

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN311297

Additional Information

Alternative name: ZMYND17

Gene ID: ZMYND17

UniProt: Q4VC12

Immunogen: The immunogen for anti-ZMYND17 antibody: synthetic peptide directed towards the C terminal of human ZMYND17

Sequence: SAHRGLYHDFWEEQVETGQTHHPDLVAAFHPGFHSSPDLM EAWLPTLLLL

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZMYND17 antibody concentration is 1 mg/ml.

Description: ZMYND17 contains 1 MYND-type zinc finger. The exact function of ZMYND17 remains unknown.

Characteristics: Antigen Size: 460 amino acids

Molecular Weight: 51kDa

Application Details

Application Notes: WB Suggested Anti-ZMYND17 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ZMYND17 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Publications

Product: Brandenberger, Wei, Zhang et al.: "Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation." in: Nature biotechnology, Vol. 22, Issue 6, pp. 707-16, 2004 (PubMed).