Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Zinc Finger Protein 226 (ZNF226) antibody

Antigen

Zinc Finger Protein 226 (ZNF226)

Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN311300
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name ZNF226
Gene ID ZNF226
UniProt Q9NYT6
Immunogen The immunogen for anti-ZNF226 antibody: synthetic peptide directed towards the C terminal of human ZNF226
Sequence KSFGRSAHLQAHQKVHTGDKPYKCDECGKGFKWSLNLDMH QRVHTGEKPY
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-ZNF226 antibody concentration is 1 mg/ml.
Description ZNF226 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 19 C2H2-type zinc fingers and 1 KRAB domain. ZNF226 may be involved in transcriptional regulation.
Characteristics Antigen Size: 803 amino acids
Molecular Weight 92kDa

Application Details

Application Notes WB Suggested Anti-ZNF226 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only

Publications

Product Grimwood, Gordon, Olsen et al.: "The DNA sequence and biology of human chromosome 19." in: Nature, Vol. 428, Issue 6982, pp. 529-35, 2004 (PubMed).

Alternatives

Alternatives for antigen "Zinc Finger Protein 226 (ZNF226)", type "Antibodies"
Hosts Rabbit (13)
Reactivities Human (13)
Applications Western Blotting (WB) (13), ELISA (3)
Epitopes Internal Region (3), Center (2), C-Term (1), N-Term (1)