Eukaryotic Translation Initiation Factor 3 Subunit H (EIF3H) antibody
| Antigen | Eukaryotic Translation Initiation Factor 3 Subunit H (EIF3H) |
| Synonyms | EIF3S3, eIF3-p40, MGC102958, eIF3-gamma, 40kD, Eif3s3, EIF3-P40, MGC107627, EIF3-gamma, 1110008A16Rik, 9430017H16Rik, MGC72941, eif3s3, eIF3h, MGC75580, eIF-3p40, En10, EIF3H |
| Clonality | Polyclonal |
| Host |
Alternatives Rabbit |
| Reactivity |
Alternatives Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Chicken, Dog (Canine), Zebrafish, Fruit Fly (Drosophila melanogaster) |
| Conjugate |
Alternatives Un-conjugated |
| Application |
Alternatives Western Blotting (WB) |
![]() |
1 reference available |
| Catalog no. | ABIN311310 |
| Quantity | 50 µg (Variants) |
| Price | 317.90 $ Plus shipping costs $45.00 |
| Shipping to |
|
| Availability | Will be delivered in 2 to 3 Business Days |
Additional Information
| Alternative name | EIF3H / EIF3S3 |
| Gene ID | EIF3H |
| UniProt | O15372 |
| Immunogen | The immunogen for anti-EIF3H antibody: synthetic peptide directed towards the C terminal of human EIF3H |
| Sequence | LMDRVDEMSQDIVKYNTYMRNTSKQQQQKHQYQQRRQQEN MQRQSRGEPP |
| Cross-Reactivity | Cow (Bovine), Dog (Canine), Chicken, Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus) |
| Format | Lyophilized |
| Reconstitution | Add 50 µl of distilled water. Final anti-EIF3H antibody concentration is 1 mg/ml. |
| Description | EIF3H belongs to the peptidase M67 family. It contains 1 MPN (JAB/Mov34) domain. EIF3H binds to the 40S ribosome and promotes the binding of methionyl-tRNAi and mRNA. It associates with the p170 subunit of EIF3. |
| Characteristics | Antigen Size: 352 amino acids |
| Molecular Weight | 40kDa |
Application Details
| Application Notes |
WB Suggested Anti-EIF3H Antibody Titration: 0.2-1 ug/ml Positive Control: Human brain. |
| Purification | Affinity Purified |
| Buffer | PBS |
| Storage (Long Term) | For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Storage (Short Term) | Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. |
| Restrictions | For Research Use only |
Publications
| Product |
Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).
|
Alternatives
Alternatives for antigen "Eukaryotic Translation Initiation Factor 3 Subunit H (EIF3H)", type "Antibodies"
| Hosts | Rabbit (33), Mouse (2) |
| Reactivities | Human (35), Mouse (Murine) (24), Rat (Rattus) (23), Cow (Bovine) (21), Chicken (20), Horse (Equine) (19), Dog (Canine) (2), Cat (Feline) (1), Xenopus laevis (1) |
| Applications | Western Blotting (WB) (18), Immunofluorescence (IF) (17), ELISA (16), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (IHC) (2), Immunoprecipitation (IP) (2), Flow Cytometry (FACS) (1), Immunoelectron Microscopy (IEM) (1) |
| Conjugates | Alexa Flour 488 (1), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1) |
| Epitopes | C-Term (4), N-Term (3) |




Alternatives