Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Eukaryotic Translation Initiation Factor 3 Subunit H (EIF3H) antibody

Antigen

Eukaryotic Translation Initiation Factor 3 Subunit H (EIF3H)

Synonyms EIF3S3, eIF3-p40, MGC102958, eIF3-gamma, 40kD, Eif3s3, EIF3-P40, MGC107627, EIF3-gamma, 1110008A16Rik, 9430017H16Rik, MGC72941, eif3s3, eIF3h, MGC75580, eIF-3p40, En10, EIF3H
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Chicken, Dog (Canine), Zebrafish, Fruit Fly (Drosophila melanogaster)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN311310
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name EIF3H / EIF3S3
Gene ID EIF3H
UniProt O15372
Immunogen The immunogen for anti-EIF3H antibody: synthetic peptide directed towards the C terminal of human EIF3H
Sequence LMDRVDEMSQDIVKYNTYMRNTSKQQQQKHQYQQRRQQEN MQRQSRGEPP
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-EIF3H antibody concentration is 1 mg/ml.
Description EIF3H belongs to the peptidase M67 family. It contains 1 MPN (JAB/Mov34) domain. EIF3H binds to the 40S ribosome and promotes the binding of methionyl-tRNAi and mRNA. It associates with the p170 subunit of EIF3.
Characteristics Antigen Size: 352 amino acids
Molecular Weight 40kDa

Application Details

Application Notes WB Suggested Anti-EIF3H Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives

Alternatives for antigen "Eukaryotic Translation Initiation Factor 3 Subunit H (EIF3H)", type "Antibodies"
Hosts Rabbit (33), Mouse (2)
Reactivities Human (35), Mouse (Murine) (24), Rat (Rattus) (23), Cow (Bovine) (21), Chicken (20), Horse (Equine) (19), Dog (Canine) (2), Cat (Feline) (1), Xenopus laevis (1)
Applications Western Blotting (WB) (18), Immunofluorescence (IF) (17), ELISA (16), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (IHC) (2), Immunoprecipitation (IP) (2), Flow Cytometry (FACS) (1), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Flour 488 (1), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes C-Term (4), N-Term (3)