Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Zinc Finger Protein 340 (ZNF340) antibody

Antigen

Zinc Finger Protein 340 (ZNF340)

Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Rat (Rattus), Mouse (Murine), Chicken, Dog (Canine), Xenopus laevis

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN311340
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name BTBD4 / ZNF340
Gene ID ZBTB46
UniProt Q86UZ6
Immunogen The immunogen for anti-ZBTB46 antibody: synthetic peptide directed towards the N terminal of human ZBTB46
Sequence MNNRKEDMEITSHYRHLLRELNEQRQHGVLCDVCVVVEGK VFKAHKNVLL
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-ZBTB46 antibody concentration is 1 mg/ml.
Description ZBTB46 contains 1 BTB (POZ) domain and 2 C2H2-type zinc fingers. ZBTB46 may be involved in transcriptional regulation.
Characteristics Antigen Size: 589 amino acids
Molecular Weight 64kDa

Application Details

Application Notes WB Suggested Anti-ZBTB46 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Placenta.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Kutsenko, Gizatullin, Al-Amin et al.: "NotI flanking sequences: a tool for gene discovery and verification of the human genome." in: Nucleic acids research, Vol. 30, Issue 14, pp. 3163-70, 2002 (PubMed).

Alternatives

Alternatives for antigen "Zinc Finger Protein 340 (ZNF340)", type "Antibodies"
Hosts Rabbit (7)
Reactivities Human (7)
Applications Western Blotting (WB) (7), ELISA (3)
Epitopes Center (2), Internal Region (1), Internal Region,AA 250-279 (1), N-Term (1)