Zinc Finger, C3HC-Type Containing 3 (ZCCHC3) antibody

Antigen: Zinc Finger, C3HC-Type Containing 3 (ZCCHC3)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN311345

Additional Information

Alternative name: ZCCHC3

Gene ID: ZCCHC3

UniProt: Q9NUD5

Immunogen: The immunogen for anti-ZCCHC3 antibody: synthetic peptide directed towards the middle region of human ZCCHC3

Sequence: RDFVVGALILRSIGMDPSDIYAVIQIPGSREFDVSFRSAE KLALFLRVYE

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZCCHC3 antibody concentration is 1 mg/ml.

Description: ZCCHC3 contains 3 CCHC-type zinc fingers. The exact function of ZCCHC3 remains unknown.

Characteristics: Antigen Size: 403 amino acids

Molecular Weight: 43kDa

Application Details

Application Notes: WB Suggested Anti-ZCCHC3 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ZCCHC3 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Publications

Product: Rush, Moritz, Lee et al.: "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells." in: Nature biotechnology, Vol. 23, Issue 1, pp. 94-101, 2005 (PubMed).