Transcription Elongation Factor A (SII)-Like 2 (TCEAL2) antibody

Antigen: Transcription Elongation Factor A (SII)-Like 2 (TCEAL2)

Synonyms: my048, MY0876G05

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN311347

Additional Information

Alternative name: TCEAL2

Gene ID: TCEAL2

UniProt: Q9H3H9

Immunogen: The immunogen for anti-TCEAL2 antibody: synthetic peptide directed towards the N terminal of human TCEAL2

Sequence: MEKLFNENEGMPSNQGKIDNEEQPPHEGKPEVACILEDKK LENEGNTENT

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TCEAL2 antibody concentration is 1 mg/ml.

Description: TCEAL2 is a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner.This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. Multiple family members are located on the X chromosome.

Characteristics: Antigen Size: 227 amino acids

Molecular Weight: 26kDa

Application Details

Application Notes: WB Suggested Anti-TCEAL2 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-TCEAL2 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Publications

Product: Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).