Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311348

Zinc Finger Protein 280A (ZNF280A) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SUHW1, ZNF280, ZNF636, 3'OY11.1
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311348
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF280A antibody: synthetic peptide directed towards the C terminal of human ZNF280A
Sequence WRHSRRRVLQCSKCRLQFLTLKEEIEHKTKDHQTFKKPEQ LQGFPRETKV
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against ZNF280A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF280A
Background The predicted protein ZNF280A is similar to Drosophila suppressor of hairy wing protein, a leucine zipper protein which represses the function of transcriptional enhancers of the gypsy retrotransposon. ZNF280A may function as a transcription factor.This gene was predicted both by automated computational analysis and by similarity to a Drosophila gene and to predicted genes in other species (sheep, chimp, dog, cow). The predicted protein of this gene is similar to Drosophila suppressor of hairy wing protein, a leucine zipper protein which represses the function of transcriptional enhancers of the gypsy retrotransposon.
Molecular Weight 60kDa
Gene ID 129025
NCBI Accession NP_542778, NM_080740
UniProt P59817
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF280A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Dunham, Shimizu, Roe et al.: "The DNA sequence of human chromosome 22." in: Nature, Vol. 402, Issue 6761, pp. 489-95, 1999 (PubMed).

Alternatives for antigen "Zinc Finger Protein 280A (ZNF280A)", type "Antibodies"
Hosts (9), (3)
Reactivities (12)
Applications (11), (7), (2), (2), (2), (1)
Epitopes (2), (2), (1), (1)
Beacon