Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Chromosome 14 Open Reading Frame 174 (C14orf174) antibody

Antigen

Chromosome 14 Open Reading Frame 174 (C14orf174)

Synonyms FAM15A, FLJ35963, MGC132494, MGC132496
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN311462
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name C14orf174
Gene ID C14orf174
UniProt Q9P1V8
Immunogen The immunogen for anti-C14orf174 antibody: synthetic peptide directed towards the N terminal of human C14orf174
Sequence FPSEKLGESLEETDLQPPKMTKPETPEETQRESTEKKRTE PPEQARLEFL
Cross-Reactivity Human
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-C14orf174 antibody concentration is 1 mg/ml.
Description C14orf174 contains 1 SAM (sterile alpha motif) domain. The exact functions of C14orf174 remain unknown.
Characteristics Antigen Size: 674 amino acids
Molecular Weight 77kDa

Application Details

Application Notes WB Suggested Anti-C14orf174 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Heilig, Eckenberg, Petit et al.: "The DNA sequence and analysis of human chromosome 14." in: Nature, Vol. 421, Issue 6923, pp. 601-7, 2003 (PubMed).

Alternatives

Alternatives for antigen "Chromosome 14 Open Reading Frame 174 (C14orf174)", type "Antibodies"
Hosts Rabbit (20)
Reactivities Human (19)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (5), ELISA (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes N-Term (1)