Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Chromosome 4 Open Reading Frame 33 (C4orf33) antibody

Antigen

Chromosome 4 Open Reading Frame 33 (C4orf33)

Synonyms FLJ33703, MGC108272, MGC197879
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN311473
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name C4orf33
Gene ID C4orf33
UniProt Q8N1A6
Immunogen The immunogen for anti-C4orf33 antibody: synthetic peptide directed towards the C terminal of human C4orf33
Sequence PNVTKFNSFAIHGSKDKRSYEALYPVPQHELQQGQKPDFH CLEYFKSFNF
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-C4orf33 antibody concentration is 1 mg/ml.
Description C4orf33 belongs to the UPF0462 family. The exact function of C4orf33 remains unknown.
Characteristics Antigen Size: 199 amino acids
Molecular Weight 23kDa

Application Details

Application Notes WB Suggested Anti-C4orf33 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Tsuritani, Irie, Yamashita et al.: "Distinct class of putative "non-conserved" promoters in humans: comparative studies of alternative promoters of human and mouse genes." in: Genome research, Vol. 17, Issue 7, pp. 1005-14, 2007 (PubMed).

Alternatives

Alternatives for antigen "Chromosome 4 Open Reading Frame 33 (C4orf33)", type "Antibodies"
Hosts Rabbit (20)
Reactivities Human (19), Cow (Bovine) (18), Dog (Canine) (18), Mouse (Murine) (18), Rat (Rattus) (18)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (5), ELISA (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1)
Epitopes C-Term (1)