Did you know that you can buy products from over 140 different suppliers from us?

Aldehyde Dehydrogenase 1 Family, Member L1 (ALDH1L1) (Middle Region) antibody

Details for Product No. ABIN311502
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms FDH, fthfd, ALDH1L1, FTHFD, DKFZp469C068, 10-FTHFDH, 10-fTHF, 1810048F20Rik, Fthfd, Neut2
Epitope
Middle Region
(7), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human
(47), (24), (18), (17), (12), (4), (1), (1)
Host
Rabbit
(30), (26)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(44), (21), (14), (13), (12), (11), (10), (4), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN311502
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ALDH1L1
Sequence LTLKAGIPKGVVNVLPGSGSLVGQRLSDHPDVRKIGFTGS TEVGKHIMKS
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against ALDH1L1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ALDH1L1
Background ALDH1L1 catalyzes the conversion of 10-formyltetrahydrofolate, NADP, and water to tetrahydrofolate, NADPH, and carbon dioxide. ALDH1L1 belongs to the aldehyde dehydrogenase family and is responsible for formate oxidation in vivo. Deficiencies in this gene can result in an accumulation of formate and subsequent methanol poisoning.The protein encoded by this gene catalyzes the conversion of 10-formyltetrahydrofolate, NADP, and water to tetrahydrofolate, NADPH, and carbon dioxide. The encoded protein belongs to the aldehyde dehydrogenase family and is responsible for formate oxidation in vivo. Deficiencies in this gene can result in an accumulation of formate and subsequent methanol poisoning.
Molecular Weight 99 kDa
Gene ID 10840
NCBI Accession NM_012190, NP_036322
UniProt O75891
Research Area Cancer, Cell Cycle, Metabolism, Apoptosis/Necrosis, Glia marker
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 902 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Aldehyde Dehydrogenase 1 Family, Member L1 (ALDH1L1) (Middle Region) antibody WB Suggested Anti-ALDH1L1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver
Background publications Lee, Lan, Kricker et al.: "One-carbon metabolism gene polymorphisms and risk of non-Hodgkin lymphoma in Australia." in: Human genetics, Vol. 122, Issue 5, pp. 525-33, 2007 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN311502
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top