Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311502

Aldehyde Dehydrogenase 1 Family, Member L1 (ALDH1L1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 10-FTHFDH, 10-fTHF, FDH, FTHFD, Fthfd, 1810048F20Rik, Neut2, fthfd, ALDH1L1, DKFZp469C068
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311502
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ALDH1L1 antibody: synthetic peptide directed towards the middle region of human ALDH1L1
Sequence LTLKAGIPKGVVNVLPGSGSLVGQRLSDHPDVRKIGFTGS TEVGKHIMKS
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against ALDH1L1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ALDH1L1
Background ALDH1L1 catalyzes the conversion of 10-formyltetrahydrofolate, NADP, and water to tetrahydrofolate, NADPH, and carbon dioxide. ALDH1L1 belongs to the aldehyde dehydrogenase family and is responsible for formate oxidation in vivo. Deficiencies in this gene can result in an accumulation of formate and subsequent methanol poisoning.The protein encoded by this gene catalyzes the conversion of 10-formyltetrahydrofolate, NADP, and water to tetrahydrofolate, NADPH, and carbon dioxide. The encoded protein belongs to the aldehyde dehydrogenase family and is responsible for formate oxidation in vivo. Deficiencies in this gene can result in an accumulation of formate and subsequent methanol poisoning.
Molecular Weight 99kDa
Gene ID 10840
NCBI Accession NP_036322, NM_012190
UniProt O75891
Research Area Cancer, Cell Cycle, Metabolism, Apoptosis/Necrosis, Glia marker
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ALDH1L1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lee, Lan, Kricker et al.: "One-carbon metabolism gene polymorphisms and risk of non-Hodgkin lymphoma in Australia." in: Human genetics, Vol. 122, Issue 5, pp. 525-33, 2007 (PubMed).

Alternatives for antigen "Aldehyde Dehydrogenase 1 Family, Member L1 (ALDH1L1)", type "Antibodies"
Hosts (28), (24)
Reactivities (43), (24), (17), (15), (12), (1)
Applications (40), (17), (15), (12), (12), (11), (10), (4), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (7), (2), (2), (1), (1), (1)
Beacon