Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Aldehyde Dehydrogenase 1 Family, Member L1 (ALDH1L1) antibody

Antigen

Aldehyde Dehydrogenase 1 Family, Member L1 (ALDH1L1)

Synonyms FTHFD, DKFZp781N0997, Fthfd, MGC105431, 1810048F20Rik, fthfd, aldh1l1, DKFZP469I2021, ALDH1L1, MGC179366, DKFZp469C068
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN311502
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name ALDH1L1 / FTHFD
Gene ID ALDH1L1
UniProt O75891
Immunogen The immunogen for anti-ALDH1L1 antibody: synthetic peptide directed towards the middle region of human ALDH1L1
Sequence LTLKAGIPKGVVNVLPGSGSLVGQRLSDHPDVRKIGFTGS TEVGKHIMKS
Cross-Reactivity Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-ALDH1L1 antibody concentration is 1 mg/ml.
Description ALDH1L1 catalyzes the conversion of 10-formyltetrahydrofolate, NADP, and water to tetrahydrofolate, NADPH, and carbon dioxide. ALDH1L1 belongs to the aldehyde dehydrogenase family and is responsible for formate oxidation in vivo. Deficiencies in this gene can result in an accumulation of formate and subsequent methanol poisoning.The protein encoded by this gene catalyzes the conversion of 10-formyltetrahydrofolate, NADP, and water to tetrahydrofolate, NADPH, and carbon dioxide. The encoded protein belongs to the aldehyde dehydrogenase family and is responsible for formate oxidation in vivo. Deficiencies in this gene can result in an accumulation of formate and subsequent methanol poisoning.
Characteristics Antigen Size: 902 amino acids
Molecular Weight 99kDa

Application Details

Application Notes WB Suggested Anti-ALDH1L1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Lee, Lan, Kricker et al.: "One-carbon metabolism gene polymorphisms and risk of non-Hodgkin lymphoma in Australia." in: Human genetics, Vol. 122, Issue 5, pp. 525-33, 2007 (PubMed).

Alternatives

Alternatives for antigen "Aldehyde Dehydrogenase 1 Family, Member L1 (ALDH1L1)", type "Antibodies"
Hosts Rabbit (26), Mouse (18)
Reactivities Human (37), Dog (Canine) (23), Mouse (Murine) (22), Rat (Rattus) (20), Horse (Equine) (18), Pig (Porcine) (18), Monkey (1)
Applications Western Blotting (WB) (26), Immunofluorescence (IF) (25), ELISA (12), Immunohistochemistry (IHC) (10), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (8), Flow Cytometry (FACS) (7), Immunostaining (ISt) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes C-Term (6), Internal Region (1)