Dynein, Light Chain, LC8-Type 2 (DYNLL2) antibody

Antigen: Dynein, Light Chain, LC8-Type 2 (DYNLL2)

Synonyms: Dlc2, DNCL1B, MGC17810, zgc:73406, wu:fd56c09, dlc2, dncl1b

Clonality: Polyclonal

Host: Rabbit

Reactivity: Caenorhabditis elegans (C. elegans), Human, Mouse (Murine), Rat (Rattus), Fruit Fly (Drosophila melanogaster), Zebrafish, Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN311522

Additional Information

Alternative name: DYNLL2

Gene ID: DYNLL2

UniProt: Q96FJ2

Immunogen: The immunogen for anti-DYNLL2 antibody: synthetic peptide directed towards the N terminal of human DYNLL2

Sequence: MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAA YIKKEFDKKY

Cross-Reactivity: Caenorhabditis elegans (C. elegans), Dog (Canine), Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-DYNLL2 antibody concentration is 1 mg/ml.

Description: DYNLL2 belongs to the dynein light chain family. DYNLL2 may be involved in some aspects of dynein-related intracellular transport and motility. It may play a role in changing or maintaining the spatial distribution of cytoskeletal structures.

Characteristics: Antigen Size: 89 amino acids

Molecular Weight: 10kDa

Application Details

Application Notes: WB Suggested Anti-DYNLL2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human heart.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-DYNLL2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human heart

Publications

Product: Pfister, Fisher, Gibbons et al.: "Cytoplasmic dynein nomenclature." in: The Journal of cell biology, Vol. 171, Issue 3, pp. 411-3, 2005 (PubMed).