Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311525

Chromosome 20 Open Reading Frame 141 (C20orf141) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms dJ860F19.4
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311525
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C20orf141 antibody: synthetic peptide directed towards the middle region of human C20orf141
Sequence RKLLTRGQSQGAGEGPGQQEALLLQMGTVSGQLSLQDALL LLLMGLGPLL
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against C20orf141. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C20orf141
Background C20orf141 is a single-pass membrane protein. The exact function of C20orf141 remains unknown.
Molecular Weight 17kDa
Gene ID 128653
NCBI Accession NP_542777, NM_080739
UniProt Q9NUB4
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C20orf141 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Deloukas, Matthews, Ashurst et al.: "The DNA sequence and comparative analysis of human chromosome 20." in: Nature, Vol. 414, Issue 6866, pp. 865-71, 2002 (PubMed).

Alternatives for antigen "Chromosome 20 Open Reading Frame 141 (C20orf141)", type "Antibodies"
Hosts (17)
Reactivities (15), (1), (1)
Applications (10), (8), (5), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (1)
Beacon