Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Chromosome 20 Open Reading Frame 141 (C20orf141) antibody

Antigen

Chromosome 20 Open Reading Frame 141 (C20orf141)

Synonyms MGC26144, dJ860F19.4
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN311525
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name C20orf141
Gene ID C20orf141
UniProt Q9NUB4
Immunogen The immunogen for anti-C20orf141 antibody: synthetic peptide directed towards the middle region of human C20orf141
Sequence RKLLTRGQSQGAGEGPGQQEALLLQMGTVSGQLSLQDALL LLLMGLGPLL
Cross-Reactivity Human
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-C20orf141 antibody concentration is 1 mg/ml.
Description C20orf141 is a single-pass membrane protein. The exact function of C20orf141 remains unknown.
Characteristics Antigen Size: 165 amino acids
Molecular Weight 17kDa

Application Details

Application Notes WB Suggested Anti-C20orf141 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Deloukas, Matthews, Ashurst et al.: "The DNA sequence and comparative analysis of human chromosome 20." in: Nature, Vol. 414, Issue 6866, pp. 865-71, 2002 (PubMed).

Alternatives

Alternatives for antigen "Chromosome 20 Open Reading Frame 141 (C20orf141)", type "Antibodies"
Hosts Rabbit (23)
Reactivities Human (21), Cow (Bovine) (1), Mouse (Murine) (1)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (8), ELISA (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes Internal Region (2)