Dual Specificity Phosphatase 19 (DUSP19) antibody

Antigen: Dual Specificity Phosphatase 19 (DUSP19)

Synonyms: SKRP1, C79103, TS-DSP1, 5930436K22Rik, DUSP17, LMWDSP3, MGC138210, Dusp19, skrp1, dusp17, ts-dsp1, MGC85046, si:dkey-237j22.1, DKFZp469B171

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN311527

Additional Information

Alternative name: DUSP19

Gene ID: DUSP19

UniProt: Q8WTR2

Immunogen: The immunogen for anti-DUSP19 antibody: synthetic peptide directed towards the C terminal of human DUSP19

Sequence: SEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESN KCDRIQENSS

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-DUSP19 antibody concentration is 1 mg/ml.

Description: DUSP19 belongs to the protein-tyrosine phosphatase family, non-receptor class dual specificity subfamily. It contains 1 tyrosine-protein phosphatase domain. DUSP19 has a dual specificity toward Ser/Thr and Tyr-containing proteins.

Characteristics: Antigen Size: 217 amino acids

Molecular Weight: 24kDa

Application Details

Application Notes: WB Suggested Anti-DUSP19 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Muscle.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling

Restrictions: For Research Use only

Images

WB Suggested Anti-DUSP19 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Muscle

Publications

Product: Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).