Pleckstrin Homology Domain Containing, Family H (With MyTH4 Domain) Member 2 (PLEKHH2) antibody

Antigen: Pleckstrin Homology Domain Containing, Family H (With MyTH4 Domain) Member 2 (PLEKHH2)

Synonyms: KIAA2028, PLEKHH1L

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Chicken, Fruit Fly (Drosophila melanogaster), Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN311541

Additional Information

Alternative name: PLEKHH2

Gene ID: PLEKHH2

UniProt: Q8IVE3

Immunogen: The immunogen for anti-PLEKHH2 antibody: synthetic peptide directed towards the C terminal of human PLEKHH2

Sequence: WQLLALCVGLFLPHHPFLWLLRLHLKRNADSRTEFGKYAI YCQRCVERTQ

Cross-Reactivity: Dog (Canine), Chicken, Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-PLEKHH2 antibody concentration is 1 mg/ml.

Description: PLEKHH2 contains 1 FERM domain, 1 MyTH4 domain and 2 PH domains. It is a Single-pass membrane protein. The exact function of PLEKHH2 remains unknown.

Characteristics: Antigen Size: 1493 amino acids

Molecular Weight: 168kDa

Application Details

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

anti-Pleckstrin Homology Domain Containing, Family H (With MyTH4 Domain) Member 2 (PLEKHH2) antibody

anti-Pleckstrin Homology Domain Containing, Family H (With MyTH4 Domain) Member 2 (PLEKHH2) antibody (Image 2)

anti-Pleckstrin Homology Domain Containing, Family H (With MyTH4 Domain) Member 2 (PLEKHH2) antibody (Image 3)

Publications

Product: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).