Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311553

FUN14 Domain Containing 1 (FUNDC1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1500005J14Rik, 1810033P05Rik, zgc:92600, fundc1-a
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Dog (Canine), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311553
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FUNDC1 antibody: synthetic peptide directed towards the N terminal of human FUNDC1
Sequence MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHS SGPMVEKYSV
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Mouse : 100%
Characteristics This is a rabbit polyclonal antibody against FUNDC1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name FUNDC1
Background FUNDC1 belongs to the FUN14 family. The exact function of FUNDC1 remains unknown.
Molecular Weight 17kDa
Gene ID 139341
NCBI Accession NP_776155, NM_173794
UniProt Q8IVP5
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FUNDC1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Alternatives for antigen "FUN14 Domain Containing 1 (FUNDC1)", type "Antibodies"
Hosts (20)
Reactivities (18), (13), (13), (13), (13), (12), (1), (1), (1)
Applications (11), (10), (5), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (2), (1), (1), (1)
Beacon