FUN14 Domain Containing 1 (FUNDC1) (N-Term) antibody

Details for Product No. ABIN311553
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms 1500005J14Rik, 1810033P05Rik, zgc:92600, fundc1-a
Epitope
N-Term
(3), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Dog (Canine), Cow (Bovine), Human, Chicken
(18), (13), (13), (13), (13), (12), (1), (1), (1)
Host
Rabbit
(20)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(11), (10), (3), (3)
Pubmed 1 reference available
Catalog no. ABIN311553
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human FUNDC1
Sequence MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHS SGPMVEKYSV
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Mouse : 100 %
Characteristics This is a rabbit polyclonal antibody against FUNDC1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FUNDC1
Background FUNDC1 belongs to the FUN14 family. The exact function of FUNDC1 remains unknown.
Molecular Weight 17 kDa
Gene ID 139341
NCBI Accession NM_173794, NP_776155
UniProt Q8IVP5
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 155 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-FUN14 Domain Containing 1 (FUNDC1) (N-Term) antibody WB Suggested Anti-FUNDC1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human heart
Background publications Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome...." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Hosts (20)
Reactivities (18), (13), (13), (13), (13), (12), (1), (1), (1)
Applications (11), (10), (3), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (1), (1), (1)
back to top