Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311579

Family with Sequence Similarity 173, Member B (FAM173B) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AA987072, A930016P21Rik, JS-2, RGD1560629
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311579
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FAM173B antibody: synthetic peptide directed towards the N terminal of human LOC134145
Sequence EGGGGIPLETLKEESQSRHVLPASFEVNSLQKSNWGFLLT GLVGGTLVAV
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against LOC134145. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name FAM173B
Background The exact function of LOC134145 remains unknown.
Molecular Weight 26kDa
Gene ID 134145
NCBI Accession NP_954584, NM_199133
UniProt Q6P4H8
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FAM173B antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lanfranchi, Muraro, Caldara et al.: "Identification of 4370 expressed sequence tags from a 3'-end-specific cDNA library of human skeletal muscle by DNA sequencing and filter hybridization." in: Genome research, Vol. 6, Issue 1, pp. 35-42, 1996 (PubMed).

Alternatives for antigen "Family with Sequence Similarity 173, Member B (FAM173B)", type "Antibodies"
Hosts (1), (1)
Reactivities (2)
Applications (2), (1), (1)
Epitopes (1), (1)
Beacon