Family with Sequence Similarity 173, Member B (FAM173B) (N-Term) antibody

Details for Product No. ABIN311579
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms AA987072, A930016P21Rik, JS-2, RGD1560629
Epitope
N-Term
(1), (1)
Reactivity
Human
(2)
Host
Rabbit
(1), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(2), (1)
Pubmed 1 reference available
Catalog no. ABIN311579
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human LOC134145
Sequence EGGGGIPLETLKEESQSRHVLPASFEVNSLQKSNWGFLLT GLVGGTLVAV
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against LOC134145. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FAM173B
Background The exact function of LOC134145 remains unknown.
Molecular Weight 26 kDa
Gene ID 134145
NCBI Accession NM_199133, NP_954584
UniProt Q6P4H8
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 233 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Family with Sequence Similarity 173, Member B (FAM173B) (N-Term) antibody WB Suggested Anti-FAM173B Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Lung
Background publications Lanfranchi, Muraro, Caldara et al.: "Identification of 4370 expressed sequence tags from a 3'-end-specific cDNA library of human skeletal muscle by DNA sequencing and filter hybridization." in: Genome research, Vol. 6, Issue 1, pp. 35-42, 1996 (PubMed).

Hosts (1), (1)
Reactivities (2)
Applications (2), (1)
Epitopes (1), (1)
back to top