Family with Sequence Similarity 173, Member B (FAM173B) antibody

Antigen: Family with Sequence Similarity 173, Member B (FAM173B)

Synonyms: AA987072, A930016P21Rik, FLJ20667, RGD1560629

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN311579

Additional Information

Alternative name: FAM173B

Gene ID: FAM173B

UniProt: Q6P4H8

Immunogen: The immunogen for anti-FAM173B antibody: synthetic peptide directed towards the N terminal of human LOC134145

Sequence: EGGGGIPLETLKEESQSRHVLPASFEVNSLQKSNWGFLLT GLVGGTLVAV

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-FAM173B antibody concentration is 1 mg/ml.

Description: The exact function of LOC134145 remains unknown.

Characteristics: Antigen Size: 233 amino acids

Molecular Weight: 26kDa

Application Details

Application Notes: WB Suggested Anti-FAM173B Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Lung.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-FAM173B Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Lung

Publications

Product: Lanfranchi, Muraro, Caldara et al.: "Identification of 4370 expressed sequence tags from a 3'-end-specific cDNA library of human skeletal muscle by DNA sequencing and filter hybridization." in: Genome research, Vol. 6, Issue 1, pp. 35-42, 1996 (PubMed).