Did you know that you can buy products from over 140 different suppliers from us?

Cysteine-Rich Secretory Protein 1 (CRISP1) (N-Term) antibody

Details for Product No. ABIN311590
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 9230112K08Rik, crisp-1, AEGL1, ARP, CRISP-1, HSCRISP1D, HSCRISP1G, HUMARP, AW324342, Aeg1, Aeg, Crisp-1, AEG
Epitope
N-Term
(8), (7), (3), (2), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Pig (Porcine), Cow (Bovine), Human
(20), (1)
Host
Rabbit
(19), (2), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(15), (7), (2), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN311590
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human CRISP1
Sequence LKMSWSEEAAQNARIFSKYCDMTESNPLERRLPNTFCGEN MHMTSYPVSW
Predicted Reactivity Bovine : 84 %, Goat : 84 %, Pig : 84 %, Rabbit : 74 %
Characteristics This is a rabbit polyclonal antibody against CRISP1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CRISP1
Background Fertilization consists of a sequence of specific cell-cell interactions culminating in the fusion of the sperm and egg plasma membranes. Recognition, binding, and fusion occur through the interaction of complementary molecules that are localized to specific domains of the sperm and egg plasma membranes. In the sperm, the postacrosomal region or equatorial segment is involved in sperm-egg plasma membrane fusion. CRISP1 is a member of the cysteine-rich secretory protein (CRISP) family. It is expressed in the epididymis, is secreted into the epididymal lumen, and binds to the postacrosomal region of the sperm head where it plays a role at fertilization in sperm-egg fusion through complementary sites localized on the egg surface.Fertilization consists of a sequence of specific cell-cell interactions culminating in the fusion of the sperm and egg plasma membranes. Recognition, binding, and fusion occur through the interaction of complementary molecules that are localized to specific domains of the sperm and egg plasma membranes. In the sperm, the postacrosomal region or equatorial segment is involved in sperm-egg plasma membrane fusion. The protein encoded by this gene is a member of the cysteine-rich secretory protein (CRISP) family. This protein is expressed in the epididymis, is secreted into the epididymal lumen, and binds to the postacrosomal region of the sperm head where it plays a role at fertilization in sperm-egg fusion through complementary sites localized on the egg surface. Two isoforms are encoded by transcript variants of this gene.
Molecular Weight 27 kDa
Gene ID 167
NCBI Accession NM_001131, NP_001122
UniProt P54107
Research Area Reproduction
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 249 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Cysteine-Rich Secretory Protein 1 (CRISP1) (N-Term) antibody WB Suggested Anti-CRISP1 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysate
Background publications Mungall, Palmer, Sims et al.: "The DNA sequence and analysis of human chromosome 6." in: Nature, Vol. 425, Issue 6960, pp. 805-11, 2003 (PubMed).

Validation Images
back to top