Cysteine-Rich Secretory Protein 1 (CRISP1) antibody

Antigen: Cysteine-Rich Secretory Protein 1 (CRISP1)

Synonyms: ARP, AEGL1, HUMARP, CRISP-1, HSCRISP1D, HSCRISP1G, 9230112K08Rik, Aeg1, AW324342, AEG, crisp-1

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Pig (Porcine)

Application: Western Blotting (WB)

Catalog no.: ABIN311590

Additional Information

Alternative name: CRISP1

Gene ID: CRISP1

UniProt: P54107

Immunogen: The immunogen for anti-CRISP1 antibody: synthetic peptide directed towards the N terminal of human CRISP1

Sequence: LKMSWSEEAAQNARIFSKYCDMTESNPLERRLPNTFCGEN MHMTSYPVSW

Cross-Reactivity: Cow (Bovine), Human, Pig (Porcine)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-CRISP1 antibody concentration is 1 mg/ml.

Description: Fertilization consists of a sequence of specific cell-cell interactions culminating in the fusion of the sperm and egg plasma membranes. Recognition, binding, and fusion occur through the interaction of complementary molecules that are localized to specific domains of the sperm and egg plasma membranes. In the sperm, the postacrosomal region or equatorial segment is involved in sperm-egg plasma membrane fusion. CRISP1 is a member of the cysteine-rich secretory protein (CRISP) family. It is expressed in the epididymis, is secreted into the epididymal lumen, and binds to the postacrosomal region of the sperm head where it plays a role at fertilization in sperm-egg fusion through complementary sites localized on the egg surface.Fertilization consists of a sequence of specific cell-cell interactions culminating in the fusion of the sperm and egg plasma membranes. Recognition, binding, and fusion occur through the interaction of complementary molecules that are localized to specific domains of the sperm and egg plasma membranes. In the sperm, the postacrosomal region or equatorial segment is involved in sperm-egg plasma membrane fusion. The protein encoded by this gene is a member of the cysteine-rich secretory protein (CRISP) family. This protein is expressed in the epididymis, is secreted into the epididymal lumen, and binds to the postacrosomal region of the sperm head where it plays a role at fertilization in sperm-egg fusion through complementary sites localized on the egg surface. Two isoforms are encoded by transcript variants of this gene.

Characteristics: Antigen Size: 249 amino acids

Molecular Weight: 27kDa

Application Details

Application Notes: WB Suggested Anti-CRISP1 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Reproduction

Restrictions: For Research Use only

Images

WB Suggested Anti-CRISP1 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysate

Publications

Product: Mungall, Palmer, Sims et al.: "The DNA sequence and analysis of human chromosome 6." in: Nature, Vol. 425, Issue 6960, pp. 805-11, 2003 (PubMed).