Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311608

Metallothionein-Like 5, Testis-Specific (Tesmin) (MTL5) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms tesmin, MTLT, CXCDC2, TESMIN, MTL5
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311608
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MTL5 antibody: synthetic peptide directed towards the N terminal of human MTL5
Sequence EAYLGPADPKEPVLHAFNPALGADCKGQVKAKLAGGDSDG GELLGEYPGI
Predicted Reactivity Human : 100%, Dog : 83%
Characteristics This is a rabbit polyclonal antibody against MTL5. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MTL5
Background Metallothionein proteins are highly conserved low-molecular-weight cysteine-rich proteins that are induced by and bind to heavy metal ions and have no enzymatic activity. They may play a central role in the regulation of cell growth and differentiation and are involved in spermatogenesis. MTL5 is a metallothionein-like protein which has been shown to be expressed differentially in mouse testis and ovary.Metallothionein proteins are highly conserved low-molecular-weight cysteine-rich proteins that are induced by and bind to heavy metal ions and have no enzymatic activity. They may play a central role in the regulation of cell growth and differentiation and are involved in spermatogenesis. This gene encodes a metallothionein-like protein which has been shown to be expressed differentially in mouse testis and ovary. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Weight 56kDa
Gene ID 9633
NCBI Accession NP_004914, NM_004923
UniProt Q9Y4I5
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MTL5 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Alternatives for antigen "Metallothionein-Like 5, Testis-Specific (Tesmin) (MTL5)", type "Antibodies"
Hosts (7), (2)
Reactivities (8)
Applications (9), (3), (1), (1)
Epitopes (3), (2), (2), (1), (1)
Beacon