Metallothionein-Like 5, Testis-Specific (Tesmin) (MTL5) (N-Term) antibody

Details for Product No. ABIN311608
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms tesmin, MTLT, CXCDC2, TESMIN, MTL5
Epitope
N-Term
(2), (2), (2), (1), (1)
Reactivity
Cow (Bovine), Dog (Canine), Human
(8)
Host
Rabbit
(7), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(9), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN311608
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human MTL5
Sequence EAYLGPADPKEPVLHAFNPALGADCKGQVKAKLAGGDSDG GELLGEYPGI
Predicted Reactivity Human : 100 %, Dog : 80 %
Characteristics This is a rabbit polyclonal antibody against MTL5. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MTL5
Background Metallothionein proteins are highly conserved low-molecular-weight cysteine-rich proteins that are induced by and bind to heavy metal ions and have no enzymatic activity. They may play a central role in the regulation of cell growth and differentiation and are involved in spermatogenesis. MTL5 is a metallothionein-like protein which has been shown to be expressed differentially in mouse testis and ovary.Metallothionein proteins are highly conserved low-molecular-weight cysteine-rich proteins that are induced by and bind to heavy metal ions and have no enzymatic activity. They may play a central role in the regulation of cell growth and differentiation and are involved in spermatogenesis. This gene encodes a metallothionein-like protein which has been shown to be expressed differentially in mouse testis and ovary. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Weight 56 kDa
Gene ID 9633
NCBI Accession NM_004923, NP_004914
UniProt Q9Y4I5
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 508 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Metallothionein-Like 5, Testis-Specific (Tesmin) (MTL5) (N-Term) antibody WB Suggested Anti-MTL5 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Hosts (7), (2)
Reactivities (8)
Applications (9), (2), (1), (1)
Epitopes (2), (2), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top