Heat Shock 70kDa Protein 4-Like (HSPA4L) antibody

Antigen: Heat Shock 70kDa Protein 4-Like (HSPA4L)

Synonyms: APG-1, Osp94

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN311621

Additional Information

Alternative name: HSPA4L / APG1

Gene ID: HSPA4L

UniProt: O95757

Immunogen: The immunogen for anti-HSPA4L antibody: synthetic peptide directed towards the C terminal of human HSPA4L

Sequence: KDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLT QDPVVKVSEI

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-HSPA4L antibody concentration is 1 mg/ml.

Description: HSPA4L belongs to the heat shock protein 70 family. HSPA4L possesses chaperone activity in vitro where it inhibits aggregation of citrate synthase.

Characteristics: Antigen Size: 839 amino acids

Molecular Weight: 92kDa

Application Details

Application Notes: WB Suggested Anti-HSPA4L Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-HSPA4L Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain

Publications

Product: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).