Did you know that you can buy products from over 140 different suppliers from us?

TP53 Target 5 (TP53TG5) (N-Term) antibody

Details for Product No. ABIN311624
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CLG01, C20orf10, TP53TG5
Epitope
N-Term
(7), (7), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human
(24), (11), (11), (11)
Host
Rabbit
(23), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(16), (9), (9), (2), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN311624
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human C20orf10
Sequence RLRTVLKNLSLLKLLKSSNRRIQELHKLAKRCWHSLLSVP KILRISSGEN
Predicted Reactivity Olive baboon :100 %,   Sumatran orangutan :100 %,   Human :100 %,   Mouse :90 %,   Rat :80 %,   Dog :80 %,  
Characteristics This is a rabbit polyclonal antibody against C20orf10. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C20orf10
Background The exact function of C20orf10 remains unknown.
Molecular Weight 32 kDa
Gene ID 27296
NCBI Accession NM_014477, NP_055292
UniProt Q9Y2B4
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 290 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-TP53 Target 5 (TP53TG5) (N-Term) antibody WB Suggested Anti-C20orf10 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysate
Background publications Deloukas, Matthews, Ashurst et al.: "The DNA sequence and comparative analysis of human chromosome 20." in: Nature, Vol. 414, Issue 6866, pp. 865-71, 2002 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN311624
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top