Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311633

Tetratricopeptide Repeat Domain 12 (TTC12) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TPARM, E330017O07Rik
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311633
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TTC12 antibody: synthetic peptide directed towards the C terminal of human TTC12
Sequence MNLCLQAPFVSEVWAVEVSRRCLSLLNSQDGGILTRAAGV LSRTLSSSLK
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Rabbit : 100%, Rat : 100%, Mouse : 92%, Pig : 92%
Characteristics This is a rabbit polyclonal antibody against TTC12. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TTC12
Background TTC12 contains 3 TPR repeats. Hypermethylation of TTC12 gene may play a role in acute lymphoblastic leukemia. Haplotypic variants in DRD2, ANKK1, TTC12, and NCAM1 are associated with comorbid alcohol and drug dependence.
Molecular Weight 81kDa
Gene ID 54970
NCBI Accession NP_060338, NM_017868
UniProt B0YJB4
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TTC12 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Yang, Kranzler, Zhao et al.: "Association of haplotypic variants in DRD2, ANKK1, TTC12 and NCAM1 to alcohol dependence in independent case control and family samples." in: Human molecular genetics, Vol. 16, Issue 23, pp. 2844-53, 2007 (PubMed).

Alternatives for antigen "Tetratricopeptide Repeat Domain 12 (TTC12)", type "Antibodies"
Hosts (3), (1)
Reactivities (3)
Applications (4), (2), (1)
Epitopes (2), (1)
Beacon