Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

GID Complex Subunit 4, VID24 Homolog (S. Cerevisiae) (GID4) antibody

Antigen

GID Complex Subunit 4, VID24 Homolog (S. Cerevisiae) (GID4)

Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN311645
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name C17orf39
Gene ID C17orf39
UniProt Q8IVV7
Immunogen The immunogen for anti-C17orf39 antibody: synthetic peptide directed towards the C terminal of human C17orf39
Sequence WDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDY VFMRWKEQFL
Cross-Reactivity Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-C17orf39 antibody concentration is 1 mg/ml.
Description The exact function of C17orf39 remains unknown.The multiprotein Mediator complex is a coactivator required for activation of RNA polymerase II transcription by DNA bound transcription factors. The protein encoded by this gene is thought to be a subunit of the Mediator complex. This gene is located within the Smith-Magenis syndrome region on chromosome 17.
Characteristics Antigen Size: 300 amino acids
Molecular Weight 33kDa

Application Details

Application Notes WB Suggested Anti-C17orf39 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Bi, Yan, Stankiewicz et al.: "Genes in a refined Smith-Magenis syndrome critical deletion interval on chromosome 17p11.2 and the syntenic region of the mouse." in: Genome research, Vol. 12, Issue 5, pp. 713-28, 2002 (PubMed).

Alternatives

Alternatives for antigen "GID Complex Subunit 4, VID24 Homolog (S. Cerevisiae) (GID4)", type "Antibodies"
Hosts Rabbit (23)
Reactivities Human (21), Mouse (Murine) (19), Rat (Rattus) (19), Cow (Bovine) (1)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (8), ELISA (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes C-Term (2)