Chromosome 20 Open Reading Frame 195 (C20orf195) (N-Term) antibody

Details for Product No. ABIN311647
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms C13H20orf195, C20orf195
Epitope
N-Term
(2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(17), (12), (12), (12), (12)
Host
Rabbit
(16), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (9), (3), (3), (2)
Pubmed 1 reference available
Catalog no. ABIN311647
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human C20orf195
Sequence RMKKVGTAQTKIQLLLLGDLLEQLDHGRAELDALLRSPDP RPFLADWALV
Predicted Reactivity Guinea pig : 85 %
Characteristics This is a rabbit polyclonal antibody against C20orf195. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C20orf195
Background The exact function of C20orf195 remains unknown.
Molecular Weight 35 kDa
Gene ID 79025
NCBI Accession NM_024059, NP_076964
UniProt Q9BVV2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 318 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 20 Open Reading Frame 195 (C20orf195) (N-Term) antibody WB Suggested Anti-C20orf195 Antibody Titration: 0.2-1 ug/ml
Positive Control: MCF7 cell lysate
Background publications Deloukas, Matthews, Ashurst et al.: "The DNA sequence and comparative analysis of human chromosome 20." in: Nature, Vol. 414, Issue 6866, pp. 865-71, 2002 (PubMed).

Hosts (16), (2)
Reactivities (17), (12), (12), (12), (12)
Applications (10), (9), (3), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (1), (1), (1)
back to top