Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311647

Chromosome 20 Open Reading Frame 195 (C20orf195) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C13H20orf195, C20orf195
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311647
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C20orf195 antibody: synthetic peptide directed towards the N terminal of human C20orf195
Sequence RMKKVGTAQTKIQLLLLGDLLEQLDHGRAELDALLRSPDP RPFLADWALV
Predicted Reactivity Guinea pig : 85%
Characteristics This is a rabbit polyclonal antibody against C20orf195. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C20orf195
Background The exact function of C20orf195 remains unknown.
Molecular Weight 35kDa
Gene ID 79025
NCBI Accession NP_076964, NM_024059
UniProt Q9BVV2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C20orf195 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Deloukas, Matthews, Ashurst et al.: "The DNA sequence and comparative analysis of human chromosome 20." in: Nature, Vol. 414, Issue 6866, pp. 865-71, 2002 (PubMed).

Alternatives for antigen "Chromosome 20 Open Reading Frame 195 (C20orf195)", type "Antibodies"
Hosts (17), (2)
Reactivities (18), (12), (12), (12), (12)
Applications (10), (10), (5), (4), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (1), (1)
Beacon