Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311650

Calmin (CLMN) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 9330188N17Rik, AI428889, AI788815, mKIAA1188
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311650
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CLMN antibody: synthetic peptide directed towards the C terminal of human CLMN
Sequence LEENVTKESISSKKKEKRKHVDHVESSLFVAPGSVQSSDD LEEDSSDYSI
Predicted Reactivity Human : 100%, Bovine : 76%, Dog : 76%, Mouse : 76%
Characteristics This is a rabbit polyclonal antibody against CLMN. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CLMN
Background CLMN is a single-pass type IV membrane protein. It contains 1 actin-binding domain and 2 CH (calponin-homology) domains. The exact function of CLMN remains unknown.
Molecular Weight 110kDa
Gene ID 79789
NCBI Accession NP_079010, NM_024734
UniProt Q96JQ2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CLMN antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Heilig, Eckenberg, Petit et al.: "The DNA sequence and analysis of human chromosome 14." in: Nature, Vol. 421, Issue 6923, pp. 601-7, 2003 (PubMed).

Alternatives for antigen "Calmin (CLMN)", type "Antibodies"
Hosts (5)
Reactivities (3), (1), (1), (1), (1)
Applications (5), (2)
Epitopes (2), (1)
Beacon