Did you know that you can buy products from over 140 different suppliers from us?

rho GTPase Activating Protein 28 (ARHGAP28) (C-Term) antibody

Details for Product No. ABIN311651
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AU044757, AW550892, E130310N06, RGD1559882, ARHGAP28
Epitope
C-Term
(7), (6), (4), (2), (2), (1), (1)
Reactivity
Human
(16), (1)
Host
Rabbit
(18), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(19), (7), (1)
Pubmed 1 reference available
Catalog no. ABIN311651
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human ARHGAP28
Sequence AKFQYENRILHWQRAALSFLNGKWVKKEREESTETNRSPK HVFLFTIGLD
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ARHGAP28. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ARHGAP28
Background ARHGAP28 contains 1 Rho-GAP domain. ARHGAP28 is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.
Molecular Weight 62 kDa
Gene ID 79822
NCBI Accession NM_030672, NP_109597
UniProt Q9P2N2
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 563 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-rho GTPase Activating Protein 28 (ARHGAP28) (C-Term) antibody WB Suggested Anti-ARHGAP28 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Lung
Background publications Nusbaum, Zody, Borowsky et al.: "DNA sequence and analysis of human chromosome 18...." in: Nature, Vol. 437, Issue 7058, pp. 551-5, 2005 (PubMed).

Hosts (18), (1)
Reactivities (16), (1)
Applications (19), (7), (1)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (7), (6), (4), (2), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top