ARHGAP28 antibody (N-Term)

Catalog No. ABIN632516

Product Details anti-ARHGAP28 Antibody

Target: ARHGAP28 (rho GTPase Activating Protein 28 (ARHGAP28))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ARHGAP28 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ARHGAP28 antibody was raised against the N terminal of ARHGAP28

Purification: Affinity purified

Immunogen: ARHGAP28 antibody was raised using the N terminal of ARHGAP28 corresponding to a region with amino acids KEGSFAVPRSDSVAILETIPVLPVHSNGSPEPGQPVQNAISDDDFLEKNI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ARHGAP28 Blocking Peptide, catalog no. 33R-4334, is also available for use as a blocking control in assays to test for specificity of this ARHGAP28 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARHGAP28 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ARHGAP28

Target: ARHGAP28 (rho GTPase Activating Protein 28 (ARHGAP28))

Alternative Name: ARHGAP28 (ARHGAP28 Products)

Synonyms: RGD1559882 antibody, ARHGAP28 antibody, AU044757 antibody, AW550892 antibody, E130310N06 antibody, Rho GTPase activating protein 28 antibody, Arhgap28 antibody, ARHGAP28 antibody

Background: ARHGAP28 contains 1 Rho-GAP domain. ARHGAP28 is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.

Molecular Weight: 63 kDa (MW of target protein)