rho GTPase Activating Protein 28 (ARHGAP28) antibody

Antigen: rho GTPase Activating Protein 28 (ARHGAP28)

Synonyms: FLJ10312, DKFZp686A2038, AU044757, AW550892, E130310N06, RGD1559882, ARHGAP28

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN311651

Additional Information

Alternative name: ARHGAP28

Gene ID: ARHGAP28

UniProt: Q9P2N2

Immunogen: The immunogen for anti-ARHGAP28 antibody: synthetic peptide directed towards the C terminal of human ARHGAP28

Sequence: AKFQYENRILHWQRAALSFLNGKWVKKEREESTETNRSPK HVFLFTIGLD

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ARHGAP28 antibody concentration is 1 mg/ml.

Description: ARHGAP28 contains 1 Rho-GAP domain. ARHGAP28 is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.

Characteristics: Antigen Size: 563 amino acids

Molecular Weight: 62kDa

Application Details

Application Notes: WB Suggested Anti-ARHGAP28 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Lung.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling

Restrictions: For Research Use only

Images

WB Suggested Anti-ARHGAP28 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Lung

Publications

Product: Nusbaum, Zody, Borowsky et al.: "DNA sequence and analysis of human chromosome 18." in: Nature, Vol. 437, Issue 7058, pp. 551-5, 2005 (PubMed).