Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311676

Chromosome 7 Open Reading Frame 61 (C7orf61) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311676
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C7orf61 antibody: synthetic peptide directed towards the C terminal of human LOC402573
Sequence YLVLWAVRKHLRRLYRRQERHRRHHVRCHAAPRPNPAQSL KLDAQSPL
Predicted Reactivity Human :100%
Characteristics This is a rabbit polyclonal antibody against LOC402573. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C7orf61
Background The exact function of LOC402573 remains unknown.
Molecular Weight 24kDa
Gene ID 402573
NCBI Accession NP_001004323, NM_001004323
UniProt Q8IZ16
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C7orf61 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).

Alternatives for antigen "Chromosome 7 Open Reading Frame 61 (C7orf61)", type "Antibodies"
Hosts (15)
Reactivities (15)
Applications (10), (6), (4), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3)
Beacon