Chromosome 7 Open Reading Frame 61 (C7orf61) (C-Term) antibody

Details for Product No. ABIN311676
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
C-Term
(3)
Reactivity
Human
(16)
Host
Rabbit
(15), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (7), (3), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN311676
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human LOC402573
Sequence YLVLWAVRKHLRRLYRRQERHRRHHVRCHAAPRPNPAQSL KLDAQSPL
Predicted Reactivity Human :100 %
Characteristics This is a rabbit polyclonal antibody against LOC402573. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C7orf61
Background The exact function of LOC402573 remains unknown.
Molecular Weight 24 kDa
Gene ID 402573
NCBI Accession NM_001004323, NP_001004323
UniProt Q8IZ16
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 206 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 7 Open Reading Frame 61 (C7orf61) (C-Term) antibody WB Suggested Anti-C7orf61 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain
Background publications Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology...." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).

Hosts (15), (1)
Reactivities (16)
Applications (10), (7), (3), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top