Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

DCN1, Defective in Cullin Neddylation 1, Domain Containing 4 (S. Cerevisiae) (DCUN1D4) antibody

Antigen

DCN1, Defective in Cullin Neddylation 1, Domain Containing 4 (S. Cerevisiae) (DCUN1D4)

Synonyms FLJ42355, KIAA0276, AI836376, MGC117952, RGD1310422, si:ch211-14g4.1, MGC134196
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken, Zebrafish, Xenopus laevis

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN311697
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name DCUN1D4
Gene ID DCUN1D4
UniProt Q92564
Immunogen The immunogen for anti-DCUN1D4 antibody: synthetic peptide directed towards the middle region of human DCUN1D4
Sequence YLRSFLNDSTNFKLIYRYAFDFAREKDQRSLDINTAKCML GLLLGKIWPL
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-DCUN1D4 antibody concentration is 1 mg/ml.
Description DCUN1D4 contains 1 DCUN1 domain. The exact function of DCUN1D4 remains unknown.
Characteristics Antigen Size: 292 amino acids
Molecular Weight 34kDa

Application Details

Application Notes WB Suggested Anti-DCUN1D4 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human heart.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Alternatives

Alternatives for antigen "DCN1, Defective in Cullin Neddylation 1, Domain Containing 4 (S. Cerevisiae) (DCUN1D4)", type "Antibodies"
Hosts Rabbit (23)
Reactivities Human (21), Mouse (Murine) (21), Cow (Bovine) (18), Dog (Canine) (18), Rat (Rattus) (18), Zebrafish (Danio rerio) (18)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (7), ELISA (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes Internal Region (2), Middle Region (1)