Transmembrane Protein 184A (TMEM184A) antibody

Antigen: Transmembrane Protein 184A (TMEM184A)

Synonyms: MGC9712, FLJ24011

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN311703

Additional Information

Alternative name: TMEM184A

Gene ID: TMEM184A

UniProt: Q6ZMB5

Immunogen: The immunogen for anti-TMEM184A antibody: synthetic peptide directed towards the C terminal of human TMEM184A

Sequence: CQVYAEKKENSPAPPAPMQSISSGIRETVSPQDIVQDAIH NFSPAYQHYT

Cross-Reactivity: Dog (Canine), Human, Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TMEM184A antibody concentration is 1 mg/ml.

Description: TMEM184A is a multi-pass membrane proteinPotential. It belongs to the UPF0206 family. The exact function of TMEM184A remains unknown.

Characteristics: Antigen Size: 413 amino acids

Molecular Weight: 46kDa

Application Details

Application Notes: WB Suggested Anti-TMEM184A Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Placenta.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Reproduction

Restrictions: For Research Use only

Images

WB Suggested Anti-TMEM184A Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Placenta

Publications

Product: Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).