Finkel-Biskis-Reilly Murine Sarcoma Virus (FBR-MuSV) Ubiquitously Expressed (FAU) antibody

Antigen: Finkel-Biskis-Reilly Murine Sarcoma Virus (FBR-MuSV) Ubiquitously Expressed (FAU)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Xenopus laevis, Dog (Canine), Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN311722

Additional Information

Alternative name: FAU

Gene ID: FAU

UniProt: P62861

Immunogen: The immunogen for anti-FAU antibody: synthetic peptide directed towards the middle region of human FAU

Sequence: VRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGK KKGPNANS

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-FAU antibody concentration is 1 mg/ml.

Description: FAU is a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S30. Fubi is a member of the ubiquitin family, and ribosomal protein S30 belongs to the S30E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S30 is a component of the 40S subunit of the cytoplasmic ribosome.This gene is the cellular homolog of the fox sequence in the Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV). It encodes a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S30. Fubi is a member of the ubiquitin family, and ribosomal protein S30 belongs to the S30E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S30 is a component of the 40S subunit of the cytoplasmic ribosome. Pseudogenes derived from this gene are present in the genome. Similar to ribosomal protein S30, ribosomal proteins S27a and L40 are synthesized as fusion proteins with ubiquitin. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 133 amino acids

Molecular Weight: 14kDa

Application Details

Application Notes: WB Suggested Anti-FAU Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Proteolysis / Ubiquitin, DNA/RNA

Restrictions: For Research Use only

Images

WB Suggested Anti-FAU Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysate

Publications

Product: Yu, Ji, Doudna et al.: "Mass spectrometric analysis of the human 40S ribosomal subunit: native and HCV IRES-bound complexes." in: Protein science : a publication of the Protein Society, Vol. 14, Issue 6, pp. 1438-46, 2005 (PubMed).