Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN404739

All-Trans Retinoic Acid-Induced Differentiation Factor (ATRAID) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms APR--3, APR-3, APR3, C2orf28, PRO240, p18, 0610007C21Rik, AI316792, Apr3, HSPC013, apr-3, apr3, c2orf28
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN404739
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C2orf28 antibody: synthetic peptide directed towards the C terminal of human C2orf28
Sequence VCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWAT QRRKAKTS
Predicted Reactivity Human : 100%, Bovine : 86%, Dog : 86%, Rabbit : 86%, African clawed frog : 76%
Characteristics This is a rabbit polyclonal antibody against C2orf28. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C2orf28
Background The exact function of C2orf28 remains unknown.This gene is thought to be involved in apoptosis, and may also be involved in hematopoietic development and differentiation. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Molecular Weight 18kDa
Gene ID 51374
NCBI Accession NP_057169, NM_016085
UniProt Q6UW56
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C2orf28 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Yang, Yu, Fu et al.: "Identification of the distinct promoters for the two transcripts of apoptosis related protein 3 and their transcriptional regulation by NFAT and NFkappaB." in: Molecular and cellular biochemistry, Vol. 302, Issue 1-2, pp. 187-94, 2007 (PubMed).

Alternatives for antigen "All-Trans Retinoic Acid-Induced Differentiation Factor (ATRAID)", type "Antibodies"
Hosts (21), (3)
Reactivities (24), (17), (17)
Applications (15), (10), (9), (5), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (3)
Beacon