Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN404753

CKLF-Like MARVEL Transmembrane Domain Containing 2 (CMTM2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CKLFSF2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN404753
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CMTM2 antibody: synthetic peptide directed towards the N terminal of human CMTM2
Sequence DKPQKAVQDHKEPSDKPQKAVQPKHEVGTRRGCRRYRWEL KDSNKEFWLL
Predicted Reactivity Human : 100%, Rabbit : 100%, Horse : 93%, Bovine : 86%, Dog : 86%, Mouse : 78%
Characteristics This is a rabbit polyclonal antibody against CMTM2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CMTM2
Background CMTM2 belongs to the chemokine-like factor superfamily, a novel family that links the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein may play an important role in testicular development. This gene belongs to the chemokine-like factor gene superfamily, a novel family that links the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein encoded by this gene may play an important role in testicular development.
Molecular Weight 27kDa
Gene ID 146225
NCBI Accession NP_653274, NM_144673
UniProt Q8TAZ6
Research Area Stem Cells
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CMTM2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Fan, Liu, Hao et al.: "Crystal structure of uroporphyrinogen decarboxylase from Bacillus subtilis." in: Journal of bacteriology, Vol. 189, Issue 9, pp. 3573-80, 2007 (PubMed).

Background publications Liu, Xin, Chen et al.: "Expression and localization of CKLFSF2 in human spermatogenesis." in: Asian journal of andrology, Vol. 9, Issue 2, pp. 189-98, 2007 (PubMed).

Alternatives for antigen "CKLF-Like MARVEL Transmembrane Domain Containing 2 (CMTM2)", type "Antibodies"
Hosts (30), (2)
Reactivities (19), (12), (12)
Applications (20), (14), (6), (6), (2), (1), (1)
Conjugates (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (2), (2), (1)
Beacon