Did you know that you can buy products from over 140 different suppliers from us?

CKLF-Like MARVEL Transmembrane Domain Containing 2 (CMTM2) (N-Term) antibody

Details for Product No. ABIN404753
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CKLFSF2
Epitope
N-Term
(2), (2), (1), (1)
Reactivity
Mouse (Murine), Cow (Bovine), Human
(21), (12), (12)
Host
Rabbit
(32), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application
Western Blotting (WB)
(20), (16), (6), (3), (2), (1), (1)
Pubmed 2 references available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN404753
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human CMTM2
Sequence DKPQKAVQDHKEPSDKPQKAVQPKHEVGTRRGCRRYRWEL KDSNKEFWLL
Predicted Reactivity Human : 100 %, Rabbit : 100 %, Horse : 90 %, Bovine : 80 %, Dog : 80 %, Mouse : 70 %
Characteristics This is a rabbit polyclonal antibody against CMTM2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CMTM2
Background CMTM2 belongs to the chemokine-like factor superfamily, a novel family that links the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein may play an important role in testicular development. This gene belongs to the chemokine-like factor gene superfamily, a novel family that links the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein encoded by this gene may play an important role in testicular development.
Molecular Weight 27 kDa
Gene ID 146225
NCBI Accession NM_144673, NP_653274
UniProt Q8TAZ6
Research Area Stem Cells
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 248 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-CKLF-Like MARVEL Transmembrane Domain Containing 2 (CMTM2) (N-Term) antibody WB Suggested Anti-CMTM2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Placenta
Product cited in: Fan, Liu, Hao et al.: "Crystal structure of uroporphyrinogen decarboxylase from Bacillus subtilis." in: Journal of bacteriology, Vol. 189, Issue 9, pp. 3573-80, 2007 (PubMed).

Background publications Liu, Xin, Chen et al.: "Expression and localization of CKLFSF2 in human spermatogenesis." in: Asian journal of andrology, Vol. 9, Issue 2, pp. 189-98, 2007 (PubMed).

Validation Images
back to top