Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN404799

Neurogenic Differentiation 4 (NEUROD4) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AI846749, ATH-3, Atoh3, MATH-3, Math3, bHLHa4, ath3, zath3, ath-3, atoh3, bhlha4, math-3, xath-3, ATH3
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Dog (Canine), Cow (Bovine), Pig (Porcine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN404799
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NEUROD4 antibody: synthetic peptide directed towards the middle region of human NEUROD4
Sequence GHMETHLLHLKPQVFKSLGESSFGSHLPDCSTPPYEGPLT PPLSISGNFS
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against NEUROD4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name NEUROD4
Background The specific function of the protein remains unknown.
Molecular Weight 37kDa
Gene ID 58158
NCBI Accession NP_067014, NM_021191
UniProt B2RAC9
Research Area Neurology, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NEUROD4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Horikawa, Horikawa, Cox et al.: "beta-cell transcription factors and diabetes: no evidence for diabetes-associated mutations in the gene encoding the basic helix-loop-helix transcription factor neurogenic differentiation 4 (NEUROD4) in Japanese patients with MODY." in: Diabetes, Vol. 49, Issue 11, pp. 1955-7, 2000 (PubMed).

Alternatives for antigen "Neurogenic Differentiation 4 (NEUROD4)", type "Antibodies"
Hosts (4), (4)
Reactivities (8), (1), (1), (1), (1)
Applications (7), (3), (1), (1)
Epitopes (3), (2), (1)
Beacon